SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330507187|ref|YP_004383615.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330507187|ref|YP_004383615.1|
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 3.66e-106
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330507187|ref|YP_004383615.1|
Sequence length 274
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanosaeta concilii GP6]
Sequence
MFKIGFVKLGNIATSTAIDLSLDEIAERTDIEFKIISFGPKMTEKEGKGAEELKAWQPQL
VVISSPNAATAGPTAAREAYRGIPTIIISDGPSKKEAREALSAEGYGYIILPMDPLIGAK
REFLDPAEMALFNSDALRVLAACGAIRLVEEELDRTIASIISGQAKLPTILATPEKCAER
MHFSNPYAQAKAMGALYMAQTVASIDAAACFRLKELKPIALTAAAGHEVMRAAARLADEA
RELEKSNDTVSRQPHARTGELMQKLSLLDKPEKI
Download sequence
Identical sequences F4BZ98
WP_013718846.1.75657 gi|330507187|ref|YP_004383615.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]