SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330507646|ref|YP_004384074.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330507646|ref|YP_004384074.1|
Domain Number 1 Region: 101-407
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 2.63e-43
Family TM0189-like 0.029
Further Details:      
 
Domain Number 2 Region: 31-86
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000209
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330507646|ref|YP_004384074.1|
Sequence length 414
Comment periplasmic binding protein [Methanosaeta concilii GP6]
Sequence
MNRPICIASTLLIALTASMAGIAIGSDFTLNIFGNANMDDRIDQTDIDYIQEIINGSKEA
TMLSDVNLDGTVDLSDLQLAEELIEDRAERISLIDGNKQNLTLELPLERILTLNMRHAIA
LAVLGGEEKAVGVDNTVGERVELFPRLSQLPAVGTTSEPDIESIISLQPDLVVTFTNAPS
TDALEDKLPEGMAVLRFDLSRSSSLREEMAVLGFLLDDPDSTQRYLDWYDRYIGEIQDKA
ARIEDEDRARVLMERERSADTGPTARWAYASGTGFTDLVDLAGGINIASGYMEGNKDLET
EFVIDKDPQVIIGLSYKGGYKSSDPESMKAYYDEIMKTEGFGNISAVRDGRVHIISGDFS
IGPQLVVGALTVAKWLYPEQFQDVDPVQVHREFLSDLMKLDYDPTENGAFVYPE
Download sequence
Identical sequences A0A0W8FA63 F4BU58
gi|330507646|ref|YP_004384074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]