SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330508045|ref|YP_004384473.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330508045|ref|YP_004384473.1|
Domain Number 1 Region: 105-409
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 4.32e-47
Family TM0189-like 0.023
Further Details:      
 
Domain Number 2 Region: 44-103
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000379
Family Type I dockerin domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330508045|ref|YP_004384473.1|
Sequence length 447
Comment periplasmic binding protein [Methanosaeta concilii GP6]
Sequence
MPDGSLRLQDGGRGRGKMVMIPLKALMLAFALLMLSASGNGYVLHIFGNANLDDDINDQD
LAYLERIIEGTEEPTWLSDADNNGEIDESDISLVQSIINGTPSEITIVDSDNKTVTVKQP
LERLVVYTHQCAEILQLLGAEEKVVGVRDTFAEQPNRFPRLSKYQSIGSGGEPDVEAVLK
TNPDAILAYTWYPSEESLDDKLPPEVEVLRFDCECSGQGPDDMRERVRLLGILMGARDRA
EEYLQWHDAILDQVEDEVRKIPQNERVRVYLESTPEGDRPMSSRTAIGTGHAAHKLVEMA
GGVNIAAGRLPGYEDTAFEYGEIETEWVLSQNPEVIVGRAMGPGIRPYENVNDSLLESYA
QDIRSLPGFDEVRAVKNDGIYIITNDYAITPNYPSAVLLLARWFYPDRFADIDPQAAHQE
YVNMMGLDYDVREKGAFFFSEEQAEDL
Download sequence
Identical sequences A0A0W8F9T0 F4BX99
WP_013719695.1.75657 gi|330508045|ref|YP_004384473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]