SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330508066|ref|YP_004384494.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330508066|ref|YP_004384494.1|
Domain Number 1 Region: 93-176
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.000000785
Family TM0189-like 0.058
Further Details:      
 
Domain Number 2 Region: 30-88
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000017
Family Type I dockerin domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330508066|ref|YP_004384494.1|
Sequence length 249
Comment hypothetical protein MCON_2153 [Methanosaeta concilii GP6]
Sequence
MIDKGCMMISLCILFFAVSPADALDVRLDVFGNANLDDIIDEEDIAYVKDIMKGSAETTE
LADANYDQEVDEEDIAQIERIINGTESSLTFIDIFGDAETVNKPINHVAALGYIGPQLLR
LIGAEDRMLPVVGPDYSNYPVFWGEISQWHSVGNTPPDVDFEHVLSLSPDAVQTNLEFLN
YANDAGRKMKEEFHRNLPGIPLICLNAREPEHTSATVLIYGYIFEGFDLAPIRRALNSCV
NIFNLYGCF
Download sequence
Identical sequences F4BXJ8
gi|330508066|ref|YP_004384494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]