SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330508071|ref|YP_004384499.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330508071|ref|YP_004384499.1|
Domain Number 1 Region: 109-414
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 4.32e-52
Family TM0189-like 0.014
Further Details:      
 
Domain Number 2 Region: 35-91
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000405
Family Type I dockerin domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330508071|ref|YP_004384499.1|
Sequence length 420
Comment periplasmic binding protein [Methanosaeta concilii GP6]
Sequence
MKMKRSSEFVMLLIALCASSCAICSSSLAFSYTLNIFGNANMDDAINESDIAYLEDVIAG
RSPATELSDANLDGIVDGKDIEQVERLIDGTGEQLTLKAYTIYEELMNVTIPMPVERIVV
LNLACAESVRGIKAQDKIVGVGSSLVEGANRDFFPEMIDLPTVGKWSEPDIEAIISLNPD
IVIADLRTPDPEKLEDKLEGTGITVVRMGFTYPDYSSSEIMALGYILDRKDDARELNSFA
GKYSDLIEERLSSIAESERPRVYPIYYTSADLWKTGSNGSIVDMLCGLAGGENIAHDLTG
GTGGMYPTVDPEWVVGENPQIIFTWSSPGGYSLANDSAMRELWTKIVQAPELSRVDAAKD
ERVHLMTTEITSRPRWFVGLSYLAKWFYPEKFLDLDPEAIHKEYLERFQGLEYQGIFVYP
Download sequence
Identical sequences F4BXK3
gi|330508071|ref|YP_004384499.1| WP_013719720.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]