SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330508678|ref|YP_004385106.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330508678|ref|YP_004385106.1|
Domain Number 1 Region: 2126-2212
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000642
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 422-512
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000785
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 2041-2131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000016
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 679-771
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000218
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 501-584
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000042
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 1783-1860
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000491
Family I set domains 0.072
Further Details:      
 
Domain Number 7 Region: 1694-1775
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000232
Family I set domains 0.054
Further Details:      
 
Domain Number 8 Region: 1188-1265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000366
Family I set domains 0.031
Further Details:      
 
Domain Number 9 Region: 764-840
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000452
Family I set domains 0.047
Further Details:      
 
Domain Number 10 Region: 1871-1961
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000047
Family I set domains 0.017
Further Details:      
 
Domain Number 11 Region: 589-658
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000586
Family I set domains 0.037
Further Details:      
 
Domain Number 12 Region: 1276-1366
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000827
Family I set domains 0.049
Further Details:      
 
Domain Number 13 Region: 1949-2028
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000136
Family I set domains 0.013
Further Details:      
 
Domain Number 14 Region: 1529-1608
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000266
Family I set domains 0.032
Further Details:      
 
Domain Number 15 Region: 1359-1435
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000281
Family I set domains 0.04
Further Details:      
 
Domain Number 16 Region: 1019-1098
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000286
Family I set domains 0.017
Further Details:      
 
Domain Number 17 Region: 1616-1706
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000336
Family I set domains 0.0095
Further Details:      
 
Domain Number 18 Region: 1100-1180
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000476
Family I set domains 0.054
Further Details:      
 
Domain Number 19 Region: 1444-1521
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000844
Family I set domains 0.026
Further Details:      
 
Domain Number 20 Region: 845-925
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000173
Family I set domains 0.032
Further Details:      
 
Domain Number 21 Region: 934-1011
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000426
Family I set domains 0.033
Further Details:      
 
Domain Number 22 Region: 2205-2293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000598
Family I set domains 0.026
Further Details:      
 
Weak hits

Sequence:  gi|330508678|ref|YP_004385106.1|
Domain Number - Region: 74-279,308-389,436-469
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00706
Family Quinoprotein alcohol dehydrogenase-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330508678|ref|YP_004385106.1|
Sequence length 2314
Comment hypothetical protein MCON_2937 [Methanosaeta concilii GP6]
Sequence
MKNYSCNKWLILVIFLAALTILCCQSAYCSQPCIAMDLNASFGGSFDDELYSIQRTSDAG
YIATGRTKSYGDNNYDLFLIKADKSGNILWQKNYGGAREDEGYSVEETADGGYIVAGRTR
SYGSGMYDVWLMKVDPSGEKIWDKAFGGALDDEASSIKQTIDGGFIIAGNTKSFGSGMYD
VWLLKIDQFGGKIWDKTIGGSRDDMGDSIQETRDGGFVVAGTTGSWGNGDSDALLIKIDS
NGNEQWKKTFGGPRSERNPWSRGWSVQQTADGGFAMLGSTNSVGSGGYDIWFIKTDANGD
KIADKVYGGAYDEEGGSLVKTREGHHILIGSTRSFGSGGFDAWLIMTDQNGERIWDQTFG
SKLDDKGYSVIQTDDGSSVFAGKTTPYIAQTTRRKSACYGDCQQQEPATYYDGWLVAIRS
AHPMIEIQPADYSACEDQEARFNVVAAGNGPISYQWSKNGSQIAGATTDSYIIPAAKLAD
AGSYRVRVSNACGSIESNPAVLTVSSKPVVEIEPLDEIACEGSEVLLNAQASGTEPLNYQ
WKKNGENITGANTNRYLISSILPTDEGDYSLAVSNICGMAESGAVHISVRSRPKILVQPI
SQTVCTGSPVSFEVQVAGNESYTYQWQKDGLNITAANAAVLSISAANSTDQGNYSVIIGS
DLCGWTQSDKAKLSIRSMPMITGLHLPASKKICEGSDIALVADVTGSDPITIQWMKDGLQ
IPGANLDSFVIKNATRNDSGSYSLIVSNDCGQIESIASYLNIATRPEILVQPANLRVCQG
AAATFSVQAKSSEPLSYQWFKDGIKIDGATSEYYTIPQTNLSDMGSYSVQVANNCSQVES
EAAGLDIITMPKILLQPANLKICQGAAAKFEVQAESSEPLSYQWLKDGVNIPAATSDTYA
IPASNLNDTGSYSVQITNNCSQIESEAADLDIIARPKILLHPANLKICQGAKAKFEVQIE
STEPLKYQWLKDGIEIPGATDDRYTIDLADIADMGSYSVLVANSCSQIESEAASLDIIAM
PDILAQPTSQNVCQGTRAAFSVQAESSEPLSYQWLKEGIKIEGATSESYTIPQTSLSDTG
SYSVQVSNNCSRIESEAAVLDIIAMPDILAQPTSQKVCQGTAATFSVQARSSEPLSYQWL
KDGVNIQGAASDTYTIPASNLNDTGSYSVQLRNNCSQIESEAADLDIIVMPQILSQPTSQ
NVCQGTRAAFSVQAKSSEPLSYQWFKDGIKIDGATSESYAIPAASLSDTGSYSVQVSNNC
SQIKSEAASLNIIAIPEILIQPVGQRGCEGATTTFSVQAESSEPLSYQWFKDGIKIDGAT
SEYYTIPQTNLSDMGSYSVQVSNNCSQIESEAANLDIIARPKILLQPANLKICQGAAAKF
EVQAESSEPLSYQWLKDGANIPGATSDTYTIPAAKLNDTGSYSVQVANNCSQIESEVSSL
DIIARPKILLQPANLMICQGAAATFHVEASSYEPIEYQWLKDGIEIPGATDDRYTIDLAD
IADVGSYSVLVANNCSQVESEAASLDIIAMPDILAQPTRQRICQGTMVTFAVQAKSSEPL
RYQWLKDGVNIPGAASDTYTIPAANLSDMGSYSVQVSNNCSQIESEAAVLDIIAMPDILA
QPTGQKVCQGTAATFSVQAKSSEPLSYQWLRDGANIPDATSESYTILAANLSDTGSYSVL
VANKCNQIESEAVRLDVISSPDILVQPKSLETCEGAAATFGVKASGGEPLEYQWYKDGTE
IEGATSNSYSIPVASPSDRGSYWVQVRNSCSQIGSNAAILDIVAKPEILVPPTSQKICQG
SAVTFTVQVESSKPLSYQWFKDGIKIPGATQDVYTIARAVLNDTGSYWVQAANNCSQIKS
GAAVLEIVALPEIHLPPASQKVCEGAAATFFVQAESSEALSYQWFKDGIEIYEATADAYT
IPRTGKFDMGNYMVQVRNSCGSVESKAAYLEMVSMPKILVPPKGQRVCQGDAATFSVQAS
SSEPLSYQWFKDGKMIQGATADTYTIPAATFGDTASYSVQIRDRCNLIESEAANLQTIGV
PAISLQPASQIVCQGTPVTFNVRAISDDPLSYQWFKDGVEIPGAIAEVYTIQKAITGDKG
SYYVQARNSCGQIESETANLDIIALPEILVQPTSQKVCEGSTATFTVLAKSAQPLTYQWI
KGGRIIPGANSEELTIFDANMEDMGEYRVAISNGCGFIDSNAVSLIVERPPGDVEIEPDC
LIADAGETVAFIMKGTAVGANSYQWEKNGEIIPGEVSPSLIILNPRPSDSGGYRLTVSNG
CGSNKSKMSVLRVVEDSTKVDPCLNPLSACCNSS
Download sequence
Identical sequences F4C0V0
gi|330508678|ref|YP_004385106.1| WP_013720311.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]