SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330508882|ref|YP_004385310.1| from Methanosaeta concilii GP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330508882|ref|YP_004385310.1|
Domain Number 1 Region: 215-320
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000000117
Family mono-SIS domain 0.0032
Further Details:      
 
Domain Number 2 Region: 39-138
Classification Level Classification E-value
Superfamily SIS domain 0.000000303
Family mono-SIS domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330508882|ref|YP_004385310.1|
Sequence length 396
Comment hypothetical protein MCON_3204 [Methanosaeta concilii GP6]
Sequence
MSGLIETFRESTNLQCSFLEKLLDLDMPSVAAFSESMVDFLKPIPENKFVYGLAAGRSAL
ALYSFMQLIQNHFENVFPFTLEDPVQRHYRKGMNLGIAISGSGETQSVNKYISDFITRGG
DIKLITANKEGTAYKMVSEYEKGDVLVIEARTKHATDKDMRSRLSPLGTEFELEVLAFLN
ALFADIQCRLKGICDPNCPEYRSIIMDLMENASLISRMDPEHLENWLIRLLPRSGRYIIG
GVGRSGLVARAFEMRFTHLNKISYWERDFNTPSFQIGDVYIPITGTGNTYEALEGTTLAL
KKGADVMPITANPSSRQVSILSKCKRSKDIAVVPVKEEYRSLFSGDTSSTTWLMSDYTKF
RYPIFEINASIFTNSVVAVGAEFLGIAEAGMRRMHV
Download sequence
Identical sequences A0A1V4V910 F4BUB5
gi|330508882|ref|YP_004385310.1| WP_013720513.1.75657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]