SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379003991|ref|YP_005259663.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379003991|ref|YP_005259663.1|
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily SirA-like 2.22e-23
Family SirA-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379003991|ref|YP_005259663.1|
Sequence length 75
Comment putative redox protein, regulator of disulfide bond formation [Pyrobaculum oguniense TE7]
Sequence
MPEVLDVRGKFCPIPVMETAKAITRIPVGDYLEVLATDPAADPDIKAWAKRMGHEVIKSE
KLPDGTLKIVVKRLK
Download sequence
Identical sequences H6Q9Z8
gi|379003991|ref|YP_005259663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]