SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379004220|ref|YP_005259892.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379004220|ref|YP_005259892.1|
Domain Number 1 Region: 3-114
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 7.06e-25
Family HEPN domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379004220|ref|YP_005259892.1|
Sequence length 118
Comment hypothetical protein Pogu_1258 [Pyrobaculum oguniense TE7]
Sequence
MRDEVLYWLSEARADLRHVEASMRLGDYNWACFAAQQAAEKALKALILHLLGEYPRGQDL
VVLYRRVRAHLQLGVGEAALSRLSAFYTLARYPNAGLVRPSEEIASEQAEEALATRGW
Download sequence
Identical sequences H6QA84
gi|379004220|ref|YP_005259892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]