SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379004642|ref|YP_005260314.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|379004642|ref|YP_005260314.1|
Domain Number - Region: 77-139
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 0.0334
Family CobE/GbiG C-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379004642|ref|YP_005260314.1|
Sequence length 152
Comment hypothetical protein Pogu_1680 [Pyrobaculum oguniense TE7]
Sequence
MSGDLARALLLALAVALALAVAYFLATGSPPSPVPEEALRAETLWGKIGALAYYDVVKTT
EPRLCSDGFANFTCFLSKTDATPILEALGKIGVKPEVAPVEAKWVLALDVNHTAVGFADV
NDVAEAAARAAAEPANAHFFARGAGALLKTPC
Download sequence
Identical sequences H6QAS9
gi|379004642|ref|YP_005260314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]