SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379005512|ref|YP_005261184.1| from Pyrobaculum oguniense TE7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379005512|ref|YP_005261184.1|
Domain Number 1 Region: 62-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000293
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  gi|379005512|ref|YP_005261184.1|
Domain Number - Region: 19-67
Classification Level Classification E-value
Superfamily RING/U-box 0.0233
Family RING finger domain, C3HC4 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379005512|ref|YP_005261184.1|
Sequence length 104
Comment Zinc finger, C2H2 type [Pyrobaculum oguniense TE7]
Sequence
MATELCFACTDKDYAIPATTITCSVCKKEVSWRETVTHYMGHGKKSGNDVVCPICNTKVK
QHEYRNHVRRHFAAKRGLFYICGICGRSFVTLRSLIVHISKTHE
Download sequence
Identical sequences H6QBT4
gi|379005512|ref|YP_005261184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]