SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156932372|ref|YP_001436288.1| from Cronobacter sakazakii ATCC BAA-894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156932372|ref|YP_001436288.1|
Domain Number 1 Region: 26-140
Classification Level Classification E-value
Superfamily Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 1.18e-41
Family Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) 0.00000277
Further Details:      
 
Domain Number 2 Region: 454-569
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-25
Family Thioltransferase 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|156932372|ref|YP_001436288.1|
Sequence length 574
Comment thiol:disulfide interchange protein precursor [Cronobacter sakazakii ATCC BAA-894]
Sequence
MAHRILTLILLFCSAHASASLFGQQNASQFVPADQAFAFDFQQQQHQLTLNWQIKPGYYL
YRQQIRVTPANASVAPPALPTGEPHEDEFFGKSEIYRDALSVPVTVEQAAPGATLSVTYQ
GCAEAGFCYPPETRTVPLSAVEPTESVKANAATPSAATGEQTRVNSDSPSATLPFSAFWA
LLIGIGVAFTPCVLPMYPLISGIVLGGDKRLSTRRALLLAFIYVQGMALTYTALGLVVAA
AGLQFQAALQSPWVLVTLSAVFVLLALSMFGLFTLQLPASLQTRLTLMSNRQRGGSPGGV
FAMGAIAGLICSPCTTAPLSAILLYIAQSGNLWLGGGTLYLYALGMGLPLILVTVFGNRL
LPKSGPWMEQVKTAFGFVILALPVFLLERVLGEPWGVRLWSVLGVAFFGWAFVTSLNATR
SWMRAVQIVLLGAAMICARPLQDWVFGAPVAESQAHLAFTRIATVDDLDRALAQAKGKPV
MLDLYADWCVACKEFEKYTFSAPEVQRALDGAVLLQADVTANSAADVALLKRLNVLGLPT
IIFFDAQGNEIPNGRVTGFMDAPAFATHLHNRLR
Download sequence
Identical sequences A7MMC7
WP_012123666.1.34712 WP_012123666.1.38143 WP_012123666.1.52367 WP_012123666.1.56053 WP_012123666.1.60338 WP_012123666.1.61601 WP_012123666.1.67391 WP_012123666.1.83282 WP_012123666.1.9447 290339.ESA_00148 gi|156932372|ref|YP_001436288.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]