SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|156934871|ref|YP_001438787.1| from Cronobacter sakazakii ATCC BAA-894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|156934871|ref|YP_001438787.1|
Domain Number 1 Region: 206-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000471
Further Details:      
 
Domain Number 2 Region: 1-101
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-29
Family PDI-like 0.00000381
Further Details:      
 
Domain Number 3 Region: 106-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.19e-23
Family PDI-like 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|156934871|ref|YP_001438787.1|
Sequence length 521
Comment hypothetical protein ESA_02719 [Cronobacter sakazakii ATCC BAA-894]
Sequence
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLLEIAELSDKVSFREDNTLAA
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGAVFQNEITERNVMGVPAVFMNGVE
FGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSATKLIPAASEG
GLHQIETASGAVLKARSVIVATGAKWRNMGVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAMTTEVKGD
GTKLTGLDYQDRVTGSVKHLEVAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
Download sequence
Identical sequences A7MK18
290339.ESA_02719 gi|156934871|ref|YP_001438787.1| WP_012125386.1.34712 WP_012125386.1.38143 WP_012125386.1.52367 WP_012125386.1.56053 WP_012125386.1.60338 WP_012125386.1.61601 WP_012125386.1.67391 WP_012125386.1.83282 WP_012125386.1.9447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]