SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313206042|ref|YP_004045219.1| from Riemerella anatipestifer ATCC 11845 = DSM 15868

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313206042|ref|YP_004045219.1|
Domain Number 1 Region: 30-262
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.77e-42
Family Endonuclease I 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|313206042|ref|YP_004045219.1|
Domain Number - Region: 266-323
Classification Level Classification E-value
Superfamily YWTD domain 0.0889
Family YWTD domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313206042|ref|YP_004045219.1|
Sequence length 349
Comment endonuclease i [Riemerella anatipestifer ATCC 11845 = DSM 15868]
Sequence
MKNIYLMVTLLIGGLGLAQIPNGYYDGTEGLSGYTLKSKLSEIITNGHRDRGYNGLWTAY
ATTDRDLYYENDNTILDIYSENPNGKDPYSYRYKTNQCGNYSGEGSCYNREHIIPQSLFS
KASPMRNDAHFVVPTDGYVNGKRDSYPFSVVGTATWTSKNGSKLGKNSTTGYSGTVFEPI
DEFKGDVARMILYFVTRYEKRIPSFQSGNIFNGTTTQGLEDWQLDILLTWHNQDPVSQRE
IDRNNAVYNHQSNRNPFIDHPEWVNKIWKTELSTKETHKNKDLKIYPNPVTGGKLYLSNW
KDLDKIDIFSMDGKKVKSVKSSNEIDVSELPKGVYLLKVDSRTIKFIIR
Download sequence
Identical sequences A0A162CIM6 E4T9N2
gi|313206042|ref|YP_004045219.1| WP_004920317.1.21683 WP_004920317.1.27570 WP_004920317.1.28646 WP_004920317.1.34653 WP_004920317.1.34861 WP_004920317.1.3884 WP_004920317.1.46459 WP_004920317.1.49580 WP_004920317.1.51207 WP_004920317.1.58109 WP_004920317.1.6213 WP_004920317.1.70085 WP_004920317.1.72231 WP_004920317.1.73884 WP_004920317.1.78695 WP_004920317.1.8112 WP_004920317.1.82490 WP_004920317.1.9884 gi|313206042|ref|YP_004045219.1| gi|442314770|ref|YP_007356073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]