SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313206775|ref|YP_004045952.1| from Riemerella anatipestifer ATCC 11845 = DSM 15868

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313206775|ref|YP_004045952.1|
Domain Number 1 Region: 123-180
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000235
Family Intron-encoded homing endonucleases 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|313206775|ref|YP_004045952.1|
Domain Number - Region: 41-127
Classification Level Classification E-value
Superfamily FliG 0.0706
Family FliG 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313206775|ref|YP_004045952.1|
Sequence length 254
Comment numod4 domain-containing protein [Riemerella anatipestifer ATCC 11845 = DSM 15868]
Sequence
MNNNEFGKEVWKPIEFDFEFTNDCRFEVSNLGRVRSFNKVSQGRILNGSTTGGYKIIRLK
LYRPRTEKEQQKFDELKAEISNLYNKRREHIKKYNDIASFEATTLLLEKKKKQLSQKLAR
NLKKRTINHHFLIHRLVATYFLPKPKSEETVVGHLDFDKTNNTVSNLKWMTPEENQAHQN
NSPKVISERKWRKYRGSNRTKGMKLTSTQVIHIKTQLKRNRPVKQIAKQFDISTMQVWRI
KSGENWAHIKIPES
Download sequence
Identical sequences E4TAT6
gi|386321243|ref|YP_006017405.1| gi|313206775|ref|YP_004045952.1| WP_004916259.1.12819 WP_004916259.1.28646 WP_004916259.1.34861 WP_004916259.1.3884 WP_004916259.1.46459 WP_004916259.1.49580 WP_004916259.1.58109 WP_004916259.1.6213 WP_004916259.1.70085 WP_004916259.1.72231 WP_004916259.1.73884 WP_004916259.1.78695 WP_004916259.1.8112 WP_004916259.1.9884 gi|313206775|ref|YP_004045952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]