SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|331270959|ref|YP_004385670.1| from Clostridium botulinum BKT015925

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331270959|ref|YP_004385670.1|
Domain Number 1 Region: 1-112,140-509
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.3e-160
Family Clostridium neurotoxins, catalytic domain 0.0002
Further Details:      
 
Domain Number 2 Region: 499-828
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 1.57e-113
Family Clostridium neurotoxins, "coiled-coil" domain 0.0016
Further Details:      
 
Domain Number 3 Region: 845-1021
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-36
Family Clostridium neurotoxins, the second last domain 0.00077
Further Details:      
 
Weak hits

Sequence:  gi|331270959|ref|YP_004385670.1|
Domain Number - Region: 1113-1172
Classification Level Classification E-value
Superfamily NHL repeat 0.00798
Family NHL repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|331270959|ref|YP_004385670.1|
Sequence length 1196
Comment botulinum neurotoxin type C1 nontoxic-nonhemagglutinin component [Clostridium botulinum BKT015925]
Sequence
MDINDDLNINSPVDNKNVVIVRARKTNTFFKAFKVAPNIWIAPERYYGEPLDIAEEYKLD
GGIYDSNFLSQDSERENFLQAIITLLKRINNTISGKQLLSLISTAIPFPYGYVGGGYSSP
NIFTFGKTPKSNKKLNSLVTSTIPFPFGGYRETNYIESPNNKDFYASNIVIFGPGSNIVE
NNVICYKKNDAENGMGTMAEILFQPLLTYKYNKFYIDPAMELTKCLIKSLYFLYGIKPSD
GLVVPYRLRTELDNKQFSQLNIIDLLISGGVDLEFINTNPYWFTNSYFSNSIKMFEKYKN
IYETEIEGNNAIGNDIKLRLRQKFQNSVQDIWNLNLNYFSKEFNSIIPDRFSNALKHFYR
KQYYTMDYTDNYNINGFVNGQINTKLPLSDKNTNIISKPEKVVNLVNENNISLMKSNIYG
DGLKGTTEDFYSTYKIPYNEEYEYRFNDSDNFPLNNISIEEVDSIPEIIDINPYKDNSDN
LVFTQITSMTEEVTTHTALPINYLQAQITTNENFTLSSDFSKVVSSKDKSLVYSFLDNLM
SYLETIKNDGPIDTDKKYYLWLKEVFKNYSFDINLTQEIDSSCGINEVVIWFGKALNILN
TSNSFVEEYQNSGPISLISKKDNLSEPNIEIDDIPDSLLGLSFKDLNNKLYEIYSKNIVY
FKKIYFNFLDQWWTEYYSQYFELICMAKQSILAQESLVKQIIQNKFTDLSKASIPPDTLK
LIKETTEKTFIDLSKESQISMNRVDNFLNKASICVFVEDIYPKFISYMEKYINNINIKTR
EFIQRCTNINDNEKSILINSYTFKTIDFKFLDIQGIKNFFNSQVEQVMKEMLSPYQLLLF
ATRGPNSNIIEDISGKNTLIQYTESVELVYGVNGESLYLKSPNETVEFSNNFFTNGLTNN
FTICFWLRFTGKDDDKTRLIGNKVNNCGWEIYFEDNGLVFEIIDSNGNQESVYLSNVINN
NWYYISISVDRSKDQLLIFINDKNVANVSIEQILNIYSTNVISLVNKNNSIYVEELSVLD
KTVTSEEVIRNYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPKTSLYEVNDNNKSYLSL
KNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISSENNRIQLVSSKDN
AKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWILES
Download sequence
Identical sequences Q9LBS8
gi|331270959|ref|YP_004385670.1| WP_013720854.1.1870 WP_013720854.1.26110 WP_013720854.1.2992 WP_013720854.1.47080 WP_013720854.1.51864 WP_013720854.1.55416 WP_013720854.1.67530 WP_013720854.1.72333 WP_013720854.1.82738 WP_013720854.1.85307 WP_013720854.1.87213 WP_013720854.1.92526 WP_013720854.1.96185 WP_013720854.1.97976 gi|331270959|ref|YP_004385670.1|NC_015417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]