SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397651510|ref|YP_006492091.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397651510|ref|YP_006492091.1|
Domain Number 1 Region: 7-422
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 4.84e-119
Family Alkaline phosphatase 0.0000144
Further Details:      
 
Domain Number 2 Region: 439-491
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000654
Family Type I dockerin domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397651510|ref|YP_006492091.1|
Sequence length 494
Comment alkaline phosphatase [Pyrococcus furiosus COM1]
Sequence
MKKITISSLLLLLLISTNLNLAYDSQESGIKNIIILIGDGMGMSHVQITKLVYGHLNMEE
FPIIGFELTESLSGEVTDSAAAGTAIATGVKTYNRMISVTNITGKVTNLTTLLEIAQVLG
KSTGLVTTTRITHATPAVFASHVPDRDMEEEIARQLIAHRVNVLLGGGRKKFDENTLKMA
KEQGYNIVFTKEELEKAEGEFILGLFADSHIPYVLDRKPEDVGLLEMTKKAISILEKNPN
GFFLMIEGGRIDHAAHENDIASVVAETKEFDDVVGYVLEYAKKRGDTLVIVLADHETGGL
GLGLTYGDAINEDVIRNINASVSKIASEIRATNDIKRVIKKYTGFELTEDEINYIEEAIN
LADEYALQNAIADIINKRVGVGFVSHKHTGAPVSLLAYGPGAENFAGFLHHVDTAKLIAK
LMLFGKKDIPVTILGISGVKGDITGDFKVDEQDAYVTLMMLLGERVDTELERKVDMNNNG
IIELGDVLLILQES
Download sequence
Identical sequences I6TWM7 Q8U246
Pfu-962748-001 gi|397651510|ref|YP_006492091.1| gi|18977376|ref|NP_578733.1| 186497.PF1004 WP_011012141.1.13913 WP_011012141.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]