SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652061|ref|YP_006492642.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652061|ref|YP_006492642.1|
Domain Number 1 Region: 9-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-46
Family Ribonuclease PH domain 1-like 0.00000197
Further Details:      
 
Domain Number 2 Region: 155-243
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.84e-26
Family Ribonuclease PH domain 2-like 0.0000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397652061|ref|YP_006492642.1|
Sequence length 250
Comment exosome complex exonuclease Rrp41 [Pyrococcus furiosus COM1]
Sequence
MMLKPEGLKLIDENGRRLDGRKKYELRPIKMKVGVLKNANGSAYIEWGKNKIIAAVYGPR
EIHPKHLQRPDRAILRVRYNMAPFSVEERKKPGPDRRSIEISKVIRGALEPALILEMFPR
TAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACSAGKIEGEIVLDLNKEED
NYGEADVPVAIMPIKNDITLLQMDGYLTKEEFIEAVKLAIKGAKAVYQKQREALKEKYLK
IAQEVEGSEQ
Download sequence
Identical sequences I6V052 Q8U0L9
WP_011012714.1.13913 WP_011012714.1.59273 186497.PF1568 gi|18977940|ref|NP_579297.1| Pfu-1465163-001 gi|397652061|ref|YP_006492642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]