SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652102|ref|YP_006492683.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652102|ref|YP_006492683.1|
Domain Number 1 Region: 92-235
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 6.93e-34
Family AlaX-like 0.004
Further Details:      
 
Domain Number 2 Region: 2-90
Classification Level Classification E-value
Superfamily Translation proteins 8.12e-18
Family AlaX-M N-terminal domain-like 0.00078
Further Details:      
 
Weak hits

Sequence:  gi|397652102|ref|YP_006492683.1|
Domain Number - Region: 265-317
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0294
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397652102|ref|YP_006492683.1|
Sequence length 404
Comment hypothetical protein PFC_07275 [Pyrococcus furiosus COM1]
Sequence
MERLYYIDPYLKKATAKIVDLKFEGDNVKVELDRTIFYPEGGGQPGDKGVIKGEGFEIIV
ENTIEKEGRIFHIGKLIGKTPNKGDSVELELDWDWRYGNMQIHTGQHILSAVLKKMYNLD
TTGFTIFGEYAKIEVNGEITWDIIERAELEANKIIISDLPVIIEEYHELPEELASELRKS
VAKVKGKIRIVKIGDVDITPCGGTHVRSTKEVGIIKVLRFYKKSRDLWRIEFTCGFRAIR
EINIILQDYLNSLELMSNKNPPLVKRVKELLDTTNSLEEKIEELRREIWEWKGKALIEKA
TKIGDYLVVTYVESWDMKDAQAFAVDFVKRNPKTILLLASEKYVVFARNENVPVSMRELF
RKVASELGGKGGGTDNLARGKVDAKPETILSVALEKVKETLQLD
Download sequence
Identical sequences I6UR17 Q8U4A3
gi|397652102|ref|YP_006492683.1| gi|18976557|ref|NP_577914.1| 186497.PF0185 WP_011011298.1.13913 WP_011011298.1.59273 Pfu-197000-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]