SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652200|ref|YP_006492781.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652200|ref|YP_006492781.1|
Domain Number 1 Region: 85-211
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.06e-33
Family AlaX-like 0.000000869
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Translation proteins 8.83e-22
Family AlaX-M N-terminal domain-like 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397652200|ref|YP_006492781.1|
Sequence length 214
Comment hypothetical protein PFC_07775 [Pyrococcus furiosus COM1]
Sequence
MTRLLYYEDAYLKEAKAKVLEVKDNALLLDQTIFYPTGGGQPHDRGWINGVEVLDVYKDE
EGNVWHVVKELEKFKPGDEVELKLDWEYRYKLMRIHSALHLLENVLDQILGKGNWEVVGS
GMTHEKGRLDVGYPENLNAYKEKIIELFNRYVDEGGEIKIWWEGEKRYTQIRDFDPIPCG
GTHVKDIREIGHIKKLKRSSIGRGKQRLEIWLED
Download sequence
Identical sequences I6TYC6 Q8U4J9
PfR3 Pfu-92940-001 gi|397652200|ref|YP_006492781.1| gi|18976458|ref|NP_577815.1| 186497.PF0086 WP_011011198.1.13913 WP_011011198.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]