SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652548|ref|YP_006493129.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652548|ref|YP_006493129.1|
Domain Number 1 Region: 15-218
Classification Level Classification E-value
Superfamily PDB 6.27e-80
Family PDB 0.00000000741
Further Details:      
 
Domain Number 2 Region: 139-211
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.99e-19
Family Translational machinery components 0.0014
Further Details:      
 
Domain Number 3 Region: 63-126
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.03e-18
Family Ribosomal S5 protein, N-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397652548|ref|YP_006493129.1|
Sequence length 236
Comment 30S ribosomal protein S5 [Pyrococcus furiosus COM1]
Sequence
MSQEWKEYAKRVLDEWEPKTKLGMMVKEGQITDIHEIFRRGYQIKEPEIIDVLLPEVNAR
ENQEVLDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIGHGKEVGIAIRKAINYAKLN
IIEIKRGCGSWECRCRRPHSVPFAVEGKEGSVRVRLIPGPRGLGLVIGDVGKKILRLAGV
QDVWSQTFGETRTTVNFAKAVFNALYNTNRVAISPEMIERYGIVVGRAMPTTFTLE
Download sequence
Identical sequences I6U9M0 Q8U017
gi|397652548|ref|YP_006493129.1| gi|18978176|ref|NP_579533.1| 186497.PF1804 Pfu-1674040-001 4v6u_AF 5jb3_F 5jbh_F WP_011012945.1.13913 WP_011012945.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]