SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652707|ref|YP_006493288.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652707|ref|YP_006493288.1|
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.24e-35
Family Translational machinery components 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397652707|ref|YP_006493288.1|
Sequence length 135
Comment 30S ribosomal protein S9 [Pyrococcus furiosus COM1]
Sequence
MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLILAGEEIWNSV
DIDVKVEGGGFMGQAEAARMAIARALVEWTGDMSLKEKFMKYDRTMLVGDPRRTEPHKPN
RSTKGPRAKRQKSYR
Download sequence
Identical sequences I6USI6 Q8U0E7
186497.PF1644 001555658|e4v4nBK1|212.1.1.101|BK:1-135 001555671|e4v6uAK1|212.1.1.101|AK:1-135 001924055|e5jb3K1|212.1.1.101|K:1-135 001930981|e5jbhK1|212.1.1.101|K:1-135 4v4n_BK 4v6u_AK 5jb3_K 5jbh_K WP_011012791.1.13913 WP_011012791.1.59273 gi|18978016|ref|NP_579373.1| gi|397652707|ref|YP_006493288.1| Pfu-1533412-001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]