SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397652714|ref|YP_006493295.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397652714|ref|YP_006493295.1|
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.22e-47
Family GHMP Kinase, N-terminal domain 0.0000847
Further Details:      
 
Domain Number 2 Region: 183-329
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.58e-37
Family Mevalonate kinase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397652714|ref|YP_006493295.1|
Sequence length 334
Comment mevalonate kinase [Pyrococcus furiosus COM1]
Sequence
MKVIASAPAKVILFGEHSVVYGKPAIAAAIDLRTFVEAELIREKKIRIEAHDIKVPGLTV
SFSENEIYFETDYGKAAEVLSYVREAINLVLEEADKKNVGIKVSITSQIPVGAGLGSSAA
VAVATIGAVSKLLGLELSKEEIAKMGHKTELLVQGASSGIDPTVSAIGGFIFYEKGKFEH
LPFMELPIVVGYTGSSGPTKELVAMVRKRYEEMPELIVPILEAMGKVVEKAKDVILSNVD
KEEKFERLGVLMNINHGLLDALGVSTKKLSELVYAARVAGALGAKITGAGGGGCMYALAP
NKQREVATAIRIAGGTPMITEISREGLKIEEVIK
Download sequence
Identical sequences I6V474 Q8U0F3
gi|397652714|ref|YP_006493295.1| gi|18978009|ref|NP_579366.1| WP_011012784.1.13913 WP_011012784.1.59273 Pfu-1528186-001 186497.PF1637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]