SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397650768|ref|YP_006491349.1| from Pyrococcus furiosus COM1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397650768|ref|YP_006491349.1|
Domain Number 1 Region: 57-267
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.86e-55
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 309-504
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.03e-49
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00011
Further Details:      
 
Domain Number 3 Region: 605-754
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.92e-48
Family AlaX-like 0.00072
Further Details:      
 
Domain Number 4 Region: 514-601
Classification Level Classification E-value
Superfamily Translation proteins 1.13e-19
Family AlaX-M N-terminal domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397650768|ref|YP_006491349.1|
Sequence length 914
Comment alanyl-tRNA ligase [Pyrococcus furiosus COM1]
Sequence
MEFVMKTRMFEEEGWIRKTCKVCGKPFWTLDPDRETCGDPPCDEYQFIGKPGIPKKYTLD
EMREKFLSFFEKHEVYPHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPL
TISQPSIRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKHIYWIDETVELAFEFFTKELKM
KPEDITFKENPWAGGGNAGPAFEVLYKGLEVATLVFMQYKKAPANADPSQVVIIKGEKYV
PMETKVVDTGYGLERLVWMSQGTPTAYDAVLGYVIEPLKRMAGVEKIDERILMENSRLAG
MFDIEDMGDLRYLREQVAKRVGISVEELERLIRPYELIYAIADHTKALTFMLADGVVPSN
VKAGYLARLLIRKSIRHLRELGLEVPLAEIVAMHIKELSPTFPEFKEMEDIILEMIELEE
KKYAETLRRGSDLVKREIAKLKKKGANEIPLEKLITFYESHGLTPEIVKEIAEKEGVKVH
IPDNFYSLVAKEAEKQVEEKEEEVVDFELVKDLPDTRTLYYEDPFMKEFDAKVLKVIEDW
VVLDQTAFYPEGGGQPYDTGILVVDGEEVKVTNVQKVGKVILHKVERPELFKEGTIVHGR
IDWERRIQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLSTDWARLDITHYKRISDEEIKE
IERLANRVVMENRRVRWEWLPRTEAEQKYGFRLYQGGVVPGRIIRILNIEDWDVQACGGT
HLPSTGLIGPIKILRTERIQDGVERIIFACGEAAVREWQKEREIIKRTSQILRVPPEKLP
ETAERFFNEWKEARKEVEKLRKELAKLLVYELESKVEKVGEIEFIGEIVEGSMDDLREAA
NKLRKENRVVVLVNKEGHFVVAVGDKLPYTAGEFAKLITSVAGGGGGGRKELAQGKIRDI
EKAKEAIEKVKGSL
Download sequence
Identical sequences I6U5G7
gi|397650768|ref|YP_006491349.1| WP_014835098.1.13913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]