SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325967794|ref|YP_004243986.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325967794|ref|YP_004243986.1|
Domain Number - Region: 346-372
Classification Level Classification E-value
Superfamily RING/U-box 0.0335
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325967794|ref|YP_004243986.1|
Sequence length 422
Comment hypothetical protein VMUT_0270 [Vulcanisaeta moutnovskia 768-28]
Sequence
MPYLMIGIDDTDWEGGGCTTYVMYSFIKYLVRENLTRSVIGLPRLTRLNPYVPFKTRGNA
SLSVIIYVESEDDAKDHVELMESLINQMVKRVGKTSPGIAYLVIRNMLKVDERLTWFYRK
SVRDIVTLDLARKVASKVNAKLMGGRGTIGALASLGFIPIDATYEFIAYRPEDEDRPMIN
PIDVKHWDHTTRPFTFLNINEDQVLIEPHGPDPVLFGVRGDSPYHVLAMGNYLANKYNAI
GWIIYVTNQGTNDHRSRASEYIPYRNVDLIGILMNAVFDDKGHVHLTLDDAHKAIAYRHL
GVSKELANCVGCMVEAWGGVKPNEKLDLYIEGMRVLHDRYVEVRNPRCPRCGGPMESMGR
SGLLRCKRCGFEGKLPRIIIPRNNWFLINPKASEYRHLMKPNERVGLEGLALYMPKPYLW
VY
Download sequence
Identical sequences F0QTE2
WP_013603647.1.51010 gi|325967794|ref|YP_004243986.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]