SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325968462|ref|YP_004244654.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325968462|ref|YP_004244654.1|
Domain Number - Region: 3-31
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000289
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 23-64
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.025
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325968462|ref|YP_004244654.1|
Sequence length 68
Comment hypothetical protein VMUT_0942 [Vulcanisaeta moutnovskia 768-28]
Sequence
MVICPVCGKEYANSSSLLKHVKLKSRYDPMHMAFWLEFQKYMSTPKEDWAMLTKTDLFRE
FLREKGLL
Download sequence
Identical sequences F0QXB3
WP_013604314.1.51010 gi|325968462|ref|YP_004244654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]