SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325968791|ref|YP_004244983.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325968791|ref|YP_004244983.1|
Domain Number 1 Region: 67-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000338
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  gi|325968791|ref|YP_004244983.1|
Domain Number - Region: 40-63
Classification Level Classification E-value
Superfamily TBP-interacting protein-like 0.000772
Family TBP-interacting protein-like 0.0067
Further Details:      
 
Domain Number - Region: 9-52
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0589
Family Rubredoxin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325968791|ref|YP_004244983.1|
Sequence length 130
Comment zinc finger C2H2-type domain-containing protein [Vulcanisaeta moutnovskia 768-28]
Sequence
MSTAAKALTKVVVCPLCDYMGEDANKVVDAITKAIPRPKLKCPKCGAEVDANSFVTHMRK
HGRVGGKTITCEICGAKLNGEGTFLRHIKEHLIVSVRRNGMDVYYCLVCGQEFITKNSAI
THLIKRHSLE
Download sequence
Identical sequences F0QYP8
gi|325968791|ref|YP_004244983.1| WP_013604643.1.51010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]