SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325969079|ref|YP_004245271.1| from Vulcanisaeta moutnovskia 768-28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325969079|ref|YP_004245271.1|
Domain Number 1 Region: 3-72,159-334
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 4.89e-71
Family Pyruvate kinase 0.000017
Further Details:      
 
Domain Number 2 Region: 315-444
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 7.48e-25
Family Pyruvate kinase, C-terminal domain 0.0024
Further Details:      
 
Domain Number 3 Region: 67-159
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.000000000159
Family Pyruvate kinase beta-barrel domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325969079|ref|YP_004245271.1|
Sequence length 455
Comment pyruvate kinase [Vulcanisaeta moutnovskia 768-28]
Sequence
MVVGKVKIVATIGPTSEKTEVLKELIKYVDGIRINFSHGNTEEWKSRILNARELRSDIAV
LGDLRGPGVRTGSMKPLTLNTGDSVEFRLAEEAVGNFVPIPNPSFFRVITIDDIIVMNDG
RLRLRVDRVSGNNAVLTALTAGIIAQEKAVVIKGKDYPLPILDDYDREVLKFAVEVGMDY
VGVSHVRSSDDIEEVRTELRRLGGDWIKLVAKIEGPDAVRNMKDVVCSSDYVMVARGDLG
MHFDLEEIPRIQTAIIKEAQKCGRPVMVATQLLESMIEQPVPTRAEVVDITNAVTEGVDS
LLLTGETAVGKYPVEAVQWLRRVASEYEDEVHVERDVMANITDRLALGIVQLAEDIGAKI
VIYSRGGRFVEAISRYRPRVPTYVGVSDERIMRRLRLYWGVEPILIGNIREYDEGERETL
NQLIRGGLIAKGDLVLLTHGVIDTYNDYSIRILRV
Download sequence
Identical sequences F0QTY3
WP_013604931.1.51010 gi|325969079|ref|YP_004245271.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]