SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15789544|ref|NP_279368.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15789544|ref|NP_279368.1|
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.45e-16
Family GHMP Kinase, N-terminal domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15789544|ref|NP_279368.1|
Sequence length 279
Comment hypothetical protein VNG0251C [Halobacterium sp. NRC-1]
Sequence
MSDGESAVAFAPGHVTGFFSVDTGATEAAVASGSRGAGVALSAGVTVTVTRAENTGVVLN
GTPTEIASVRGVLDALGVTARVTAETPLPLGAGFGVSGATALAAALAANEVFGCGCSENE
LVQVAHVADAEAGTGLGDVVAQARGGLPVRVEPGAPPHGSLDGVPASGRIEYVSFGGLST
SDVIGGETDALSAAGADALAALRADPTVAEFVAASRRFARAAGLVDAAVADAIAAVQAAG
GEAAMAMLGRTVFALGTGLSDAGYDAASCAIHHGGASLR
Download sequence
Identical sequences B0R2Z2 Q9HSF9
WP_010902142.1.1784 WP_010902142.1.50382 478009.OE1396R 64091.VNG0251C gi|169235255|ref|YP_001688455.1| gi|15789544|ref|NP_279368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]