SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15790259|ref|NP_280083.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15790259|ref|NP_280083.1|
Domain Number - Region: 37-94
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0751
Family Hypothetical protein VC1899 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15790259|ref|NP_280083.1|
Sequence length 132
Comment hypothetical protein VNG1189H [Halobacterium sp. NRC-1]
Sequence
MTAHARVNPTTVMVRALRGDGQHPLRLLVLVGDDSTATVTERHVAYLVAGAGDTDADATL
LTALGRITDGAHRAAEANGVAVVAPATIRNDDVDTTIHDILVATADDAGKRSVPAATTTD
DSAVAVRDATDT
Download sequence
Identical sequences Q9HQF2
64091.VNG1189H gi|15790259|ref|NP_280083.1| WP_010902859.1.1784 WP_010902859.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]