SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15791068|ref|NP_280892.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15791068|ref|NP_280892.1|
Domain Number 1 Region: 10-133
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 5.9e-29
Family Hjc-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15791068|ref|NP_280892.1|
Sequence length 141
Comment Hjr [Halobacterium sp. NRC-1]
Sequence
MANSNAKGNRRERELVNALDETGFAVMRAPASGAATKRDLPDVLAGNGEEFYAIEAKSSA
GDPIYLDGEEVESLVYFARNFGAKPRIGARFDREDWYFFHPADLHTTDAGSYRVKKQTAL
ADGTELETLAGGPERTGLDDY
Download sequence
Identical sequences B0R7F3 Q9HN49
gi|169236818|ref|YP_001690018.1| WP_010903673.1.1784 WP_010903673.1.50382 478009.OE4160F 64091.VNG2252G gi|15791068|ref|NP_280892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]