SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16554485|ref|NP_444209.1| from Halobacterium sp. NRC-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16554485|ref|NP_444209.1|
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.96e-34
Family Translational machinery components 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16554485|ref|NP_444209.1|
Sequence length 132
Comment 30S ribosomal protein S9 [Halobacterium sp. NRC-1]
Sequence
MVTNTSGKKKTAVARATVSDGEGRVRINSQPVELVEPEMARLKMLEPFRISGSDLRGDVD
IDIDVAGGGFAGQADAVRTAIARGLVEHYGDAELRDAFREFDRSLLVNDVRQRESKKWGG
PGARARYQKSYR
Download sequence
Identical sequences B0R4Y5 Q9HQJ2
478009.OE2635F 64091.VNG1139Gm gi|169235948|ref|YP_001689148.1| WP_010902818.1.1784 WP_010902818.1.50382 gi|16554485|ref|NP_444209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]