SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389851599|ref|YP_006353833.1| from Pyrococcus sp. ST04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389851599|ref|YP_006353833.1|
Domain Number 1 Region: 84-210
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-34
Family AlaX-like 0.000000511
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Translation proteins 3.18e-23
Family AlaX-M N-terminal domain-like 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389851599|ref|YP_006353833.1|
Sequence length 215
Comment alanyl-tRNA synthetase-like protein [Pyrococcus sp. ST04]
Sequence
MTRKLYYEDAYLKEAKAKVIEIRENALLLDQTIFYPTGGGQPHDRGWINGVEVLDVYKEG
DNVWHVVKEPEKFKVGDEVELKIDWDYRYKLMRIHSALHLLEHVLNEVLGYGKWELVGSG
MSVEKGRYDIAYPENINKYKQQIIDLFNKYVDEGGEMKIWWEGETRYTQIRDFEVIPCGG
THVRDISEIGHIKKLKRSSIGKGKQRIEIWLEDKA
Download sequence
Identical sequences I3RBZ8
WP_014733284.1.16002 gi|389851599|ref|YP_006353833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]