SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389851864|ref|YP_006354098.1| from Pyrococcus sp. ST04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389851864|ref|YP_006354098.1|
Domain Number 1 Region: 54-261
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.09e-58
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000094
Further Details:      
 
Domain Number 2 Region: 302-516
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 6.93e-50
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00011
Further Details:      
 
Domain Number 3 Region: 599-748
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 7.46e-49
Family AlaX-like 0.0011
Further Details:      
 
Domain Number 4 Region: 508-592
Classification Level Classification E-value
Superfamily Translation proteins 1.91e-18
Family AlaX-M N-terminal domain-like 0.00037
Further Details:      
 
Weak hits

Sequence:  gi|389851864|ref|YP_006354098.1|
Domain Number - Region: 766-852
Classification Level Classification E-value
Superfamily LuxS/MPP-like metallohydrolase 0.0153
Family MPP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389851864|ref|YP_006354098.1|
Sequence length 909
Comment alanyl-tRNA synthetase [Pyrococcus sp. ST04]
Sequence
MIKTRMFEEEGWIRKTCKVCGKPFWTLDPDRETCGDPPCDEYQFIGKPGIPKKYTLDEMR
EKFLSFFEKKGHGRVKRYPVLPRWRDDVLLVGASIMDFQPWVISGEADPPANPLTISQPS
IRFTDIDNVGITGRHFTIFEMMAHHAFNYPGKPIYWIDETVELAFEFFTKELKMKPEDIT
FKENPWAGGGNAGPAFEVLYRGLEVATLVFMQYKKAPENAPEDQVVIIKGEKYVPMETKV
VDTGYGLERLVWMSQGTPTAYDAVLGYVVEPLKKMAGVEKIDERILMENSRLAGMFDIED
MGDLRYLREQVAKRVGISVDELERLIRPYELIYAIADHTKALTFMLADGVIPSNVKAGYL
ARLLIRKSIRHLRELGLEVPLSEIVAMHIKELHKTFPEFKEMEDIILEIIDIEEKKYAET
LRRGSDLVRREVAKLKKRGINEIPLEKLITFYESHGLTPEIVKEIAEKEGVNVKIPDNFY
SLVAKEAEKQIKEEEKEIIDFELVKDLPDTRTLYYEDPFMKEFEAKVLRVVDDWVILDAT
AFYPEGGGQPYDTGVLEVNGEAVKVVNVQKVGKVILHKVERPEKFKEGIKVRGKIDWARR
IQHMRHHTGTHVLMGALVRVLGKHVWQAGSQLSTDWARLDISHYKRITEEELKKIEELAN
RIVMENRKVTWEWLPRTQAEQKYGFRLYQGGVVPGREIRVVKIEDWDVQACGGTHLPYTG
LVGPIKILRTERIQDGVERIIFACGEAAVKEWQRERDLLKKTSQILRVPPEKVPETAERF
FNEWKEARKEVEKLRKELAKLLVYELEGKVERVGDVEFIGAIVDGTMDDLREAANKLRKE
NRVVVLIGNQGHFVVAVGDGVNLNAGELAKVITSVAGGGGGGKKELAQGRVKDIGKAENA
IKEIRKRLL
Download sequence
Identical sequences I3RCR3
WP_014733549.1.16002 gi|389851864|ref|YP_006354098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]