SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|389852544|ref|YP_006354778.1| from Pyrococcus sp. ST04

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389852544|ref|YP_006354778.1|
Domain Number 1 Region: 5-148
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.97e-36
Family AlaX-like 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389852544|ref|YP_006354778.1|
Sequence length 151
Comment alanyl-tRNA synthetase [Pyrococcus sp. ST04]
Sequence
MTAEEVRAHTALHVVKGAVVKVLGKEAKWTASTYVKGNRGVLVVKFNRKPTEEEIRKIER
LANEKVRENVPIIVHELPREKAEEMFGEDMYDLFPVPDDIKILKVVEIKGWNINACNKEH
TMTTGEVGEIRIRKVRFRKSKGLLEISFDVL
Download sequence
Identical sequences I3REP3
WP_014734227.1.16002 gi|389852544|ref|YP_006354778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]