SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|337284738|ref|YP_004624212.1| from Pyrococcus yayanosii CH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337284738|ref|YP_004624212.1|
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily PH domain-like 0.0000352
Family BPHL domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|337284738|ref|YP_004624212.1|
Sequence length 105
Comment hypothetical protein PYCH_12660 [Pyrococcus yayanosii CH1]
Sequence
MALSDHLLPGEDIRFQSKSLVEYGGSRYQVIVTNKRIILYAQRGLVFKSDDVVTFKLEDI
QGIKYKEQGIIGKKGIIEIHAKTLATLSGPASEMKALYQQLLGFL
Download sequence
Identical sequences F8AFA7
gi|337284738|ref|YP_004624212.1| WP_013905996.1.67208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]