SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68249348|ref|YP_248460.1| from Haemophilus influenzae 86-028NP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68249348|ref|YP_248460.1|
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-38
Family Glutathione peroxidase-like 0.0000000753
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68249348|ref|YP_248460.1|
Sequence length 165
Comment thiol peroxidase [Haemophilus influenzae 86-028NP]
Sequence
MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFAGKRKVLNIFPSIDTGVCA
TSVRKFNQQAVKLSNTVVLCISADLPFAQARFCGAEGIENAKTVSTFRNHALHSQLGVDI
QTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAVLA
Download sequence
Identical sequences A0A0H3PEE9 Q4QME7
gi|68249348|ref|YP_248460.1| WP_005655523.1.101989 WP_005655523.1.15261 WP_005655523.1.23149 WP_005655523.1.28397 WP_005655523.1.38938 WP_005655523.1.50588 WP_005655523.1.50795 WP_005655523.1.6349 WP_005655523.1.86544 WP_005655523.1.8829 WP_005655523.1.91188 281310.NTHI0907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]