SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68248726|ref|YP_247838.1| from Haemophilus influenzae 86-028NP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68248726|ref|YP_247838.1|
Domain Number 1 Region: 72-204
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.33e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68248726|ref|YP_247838.1|
Sequence length 209
Comment glutathione S-transferase [Haemophilus influenzae 86-028NP]
Sequence
MKLYGLIGACSFVPHVALEWVKIRENADYEFEPVTRELIKSPEFLSLNPRGAVPVLVDGD
LVLSQNQAILHYLDELYPNSKLFGSKTVRDKAKAARWLAFFNSDVHKSFVPLFRLPNYAK
DNETLAHTIRQQAVEQILDQLAVANEHLESHIYFGEDISVADAYLYIMLNWCRAVGIDFS
HLTQLSAFMQRVETDQAVENVRKSEELKV
Download sequence
Identical sequences A4N5U0 Q4QP69
281310.NTHI0201 gi|68248726|ref|YP_247838.1| WP_005654237.1.10621 WP_005654237.1.15261 WP_005654237.1.17459 WP_005654237.1.20853 WP_005654237.1.23149 WP_005654237.1.23920 WP_005654237.1.25656 WP_005654237.1.27712 WP_005654237.1.28397 WP_005654237.1.32618 WP_005654237.1.34722 WP_005654237.1.37003 WP_005654237.1.38938 WP_005654237.1.39279 WP_005654237.1.40343 WP_005654237.1.40942 WP_005654237.1.42240 WP_005654237.1.44893 WP_005654237.1.4569 WP_005654237.1.50588 WP_005654237.1.50795 WP_005654237.1.5387 WP_005654237.1.53947 WP_005654237.1.56005 WP_005654237.1.59352 WP_005654237.1.59529 WP_005654237.1.62697 WP_005654237.1.63539 WP_005654237.1.64134 WP_005654237.1.74240 WP_005654237.1.74810 WP_005654237.1.75514 WP_005654237.1.75525 WP_005654237.1.79255 WP_005654237.1.79785 WP_005654237.1.82381 WP_005654237.1.8829 WP_005654237.1.90320 WP_005654237.1.91188 WP_005654237.1.91769 WP_005654237.1.99326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]