SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trilo1|349839|MIX6065_26680_81 from Trichoderma longibrachiatum ATCC 18648 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trilo1|349839|MIX6065_26680_81
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily EF-hand 1.53e-54
Family Calmodulin-like 0.000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Trilo1|349839|MIX6065_26680_81
Sequence length 190
Sequence
MGKSQSKLSQEQLAELQKSTHFDKKELQQWYKGFLKDCPSGMLSKEEFQKIYRQFFPFGD
PSSFADYVFNVFDSDKSGSIDFKEFICALSVTSRGKMEDKLDWAFQLYDIDGDGKISYDE
MLQIVEAIYKMVGSMVKLPEDEDTPEKRVKKIFRMMDKDENGSLDMEEFKEGSKRDETIV
SALSLYDGLV
Download sequence
Identical sequences A0A024SJU4 A0A2H2ZLS1 G0RA62
jgi|Trilo1|349839|MIX6065_26680_81 51453.JGI75001 jgi|Triha1|204808|CE34959_25041 XP_006962433.1.9351 jgi|Trire2|75001|estExt_GeneWisePlus.C_20900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]