SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Trilo1|7131|gm1.7131_g from Trichoderma longibrachiatum ATCC 18648 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Trilo1|7131|gm1.7131_g
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.13e-19
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Trilo1|7131|gm1.7131_g
Sequence length 83
Sequence
MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDEAVEEKDGGEKIRLGMVV
IRGNSVVMLEALERIGGDDRQNR
Download sequence
Identical sequences A0A024RW81 A0A0F9WU04 A0A1T3CTT0 G0REQ9 G9MKE5
jgi|Trilo1|7131|gm1.7131_g jgi|Trive1|32934|e_gw1.3.1916.1 jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210 51453.JGI21972 XP_006963552.1.9351 XP_013959334.1.71794 jgi|Triha1|439995|CE270146_10305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]