SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CHGT_07648 from Chaetomium globosum CBS 148.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CHGT_07648
Domain Number 1 Region: 20-317
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-46
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 424-640
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.082
Further Details:      
 
Domain Number 3 Region: 321-419
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000706
Family Rhamnogalacturonase B, RhgB, middle domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CHGT_07648
Sequence length 642
Comment | CHGG_07648 | Chaetomium globosum hypothetical protein (643 aa)
Sequence
MKLCFLSLFPLWADIASATITATESSSSINVKNDRLTFSVSKSAGTINTLTLDGQDLLGS
GGRLYLDCHCDSGYWNGGSFQLYKGTDKSGTAYAGVRISAKVDSGRTFESYYFLRDGETG
LHTFGRAAYPNGGGLGEMRFLFRPSTTIWNHLSSSDEMWSVLPTDAGRTTVQDTTYRISG
DGINAKYRTQMSDYFSKYMFAESWEYHTHHGLFSDGQGTRDGSTYGAWLVMNTKDTYYNG
PKWSDLTVDGIVYNYIISNHHGNGNPDTQKFDRTFGPQYYYFNKGPKGSSVNDLRSDAGR
FADPSWNADFYDSIAQHVPGYLPTSGRGTWNGRIHLPDGVTKAIAVLASNGRDFQDNNLA
TKARQYWGEVSPNGEITIPRVAAGTYRLTVYGTGIFGQYIQDNVVVKAGAATTTTATWTP
ESAGTELWRIGTPDRSSGDFRHGSERDTTRTNKPNQYRLYWAVHDFPKDFPNGVNFHVGK
SDIKRDFNYMQWSVFGGKGNSIRPDPYYTNVNAWNVTFDATSDQLEGKKQATLTIQLAGV
KTSAGNTDDTGKAFANLDYTVTVNGRALPVWTIPANHSSSCGARSAASCYNTRNLWTFDA
SYLKQGLNTFTLALPARATAPESAVLPESVYLQYDALRLEVA
Download sequence
Identical sequences Q2GWK6
CHGT_07648 XP_001225304.1.25026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]