SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_00179T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_00179T0
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.29e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 77-223
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.19e-21
Family Glutathione S-transferase (GST), C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_00179T0
Sequence length 228
Comment | SJAG_00179 | Schizosaccharomyces japonicus yFS275 glutathione S-transferase II (229 aa)
Sequence
MSQFTLYSLRGGPNPWKVVLIMKELNLSYETRFLDFSKKEQKSAEHIALNPNGRVPTLVD
HANNDYTVWESDAILLYLTDKYDTERRISLAHDHPEYHHELQYLFFQASGQGPMFGQAGW
FNHYHDVPIPSAVVRYRNEIKRVLGVLELIFERKEYLVDNRCTIADLSFIHWNKALTRIF
GEGKFQFTEELPTLDFEKEFPKTYAWHQRLLARPAAVATTEEYNKSQI
Download sequence
Identical sequences B6JXN9
XP_002171476.1.46972 SJAG_00179T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]