SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_00614T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_00614T0
Domain Number 1 Region: 24-124
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.81e-32
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SJAG_00614T0
Sequence length 128
Comment | SJAG_00614 | Schizosaccharomyces japonicus yFS275 thioredoxin-1 (129 aa)
Sequence
MKSLAKTLFGVSKRTFSYSSALRAVHPVVSSAVFNEKISSPKLTVADFYATWCGPCKTIH
PLLVTLSEKYDDVSFIKVDVDQMQDLAQQYGVYAMPTLMVFKNGKLLDQIVGADLKLLRM
SIAKNRLK
Download sequence
Identical sequences SJAG_00614T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]