SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_01199T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_01199T0
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.86e-66
Family Glutathione peroxidase-like 0.000000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_01199T0
Sequence length 192
Comment | SJAG_01199 | Schizosaccharomyces japonicus yFS275 thioredoxin peroxidase Tpx1 (193 aa)
Sequence
MTLRIGQPAPDFKGTAVVNGSFEEIKLSDYKGKWVFLGFYPMDFTFVCPTEIVAFSEAAS
KFAERNAQVILASTDSEYSHLAFINTPRKEGGLGGIKIPLLADHSHKISRDYGVLIEDAG
IAFRGLFLIDPNGILRQITVNDLPVGRSVEEALRLLDAFIFVEEHGEVCPANWHKGADTI
DTKNPDKYFSKH
Download sequence
Identical sequences B6K010
XP_002172453.1.46972 SJAG_01199T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]