SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_01303T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  SJAG_01303T0
Domain Number - Region: 1-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000962
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_01303T0
Sequence length 136
Comment | SJAG_01303 | Schizosaccharomyces japonicus yFS275 mitochondrial ribosomal protein subunit L51 (137 aa)
Sequence
MKEFLSRKLEVFAKENGDIEFHVIHRPNQHPSIKSYYGMVEKTSARDKKCVLANSSVNGR
NEEFITRKFSASDILEQALQCSESDGLKPRFVKQPVESLNPSVRGVWNPFSEFAKPPTVI
QKGLYKKRKTKSSHEI
Download sequence
Identical sequences SJAG_01303T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]