SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_01875T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_01875T0
Domain Number 1 Region: 11-240
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.79e-82
Family Inorganic pyrophosphatase 0.000000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_01875T0
Sequence length 279
Comment | SJAG_01875 | Schizosaccharomyces japonicus yFS275 inorganic pyrophosphatase (280 aa)
Sequence
MSNLARSLFKYQLKAIGRLHTPEFRVYCMKEGKPVSYLHDVPIASDEKTFNMIVEIPRWT
QAKCEIAIHDPLQPIRYDMKNDKIRYVPNCFPFHGYIWNYGVFPQSWENQKERDQFTGLV
GDGDPLDVCDIGGSKGKTGQIKQVKLLGALALIDQGETDWKIIVIDTQDPLAEKMNDIQD
AKRYMPGLLESTKKWFSIYKVPDGKPKNHFALNGQFLNQADTLQLVKRCHESWRTSKLRQ
ERVSERNEQATKDLAQSIIKAPETFMPDFNYPSQPYCYV
Download sequence
Identical sequences B6JZ51
XP_002173112.1.46972 SJAG_01875T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]