SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_02679T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_02679T0
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.66e-103
Family Inorganic pyrophosphatase 0.00000000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SJAG_02679T0
Sequence length 285
Comment | SJAG_02679 | Schizosaccharomyces japonicus yFS275 inorganic pyrophosphatase (286 aa)
Sequence
MSEYTTRSVGAPNTLEYNVYVEKNGKPVSSWHDIPLYANAEKTILNMVVEIPRWTQAKLE
ITKEDTLNPIKQDTKKGKLRFVRNCFPHHGYIWNYGAFPQTYEDPKSIHPETKAKGDSDP
LDVCEIGEARGYIGQVKQVKVLGVMALLDEGETDWKVIVIDVNDPLAPKLNDIEDVERHM
PGLIRATNEWFRIYKIPDGKPENSFAFSGECKNRKYAEEVVRECNEAWERLLANPGEAKE
EFGLVTESSPEYAKAAEAVPAGQDLPPAPVDPSVHKWFYISGSPL
Download sequence
Identical sequences B6K0W1
XP_002173875.1.46972 SJAG_02679T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]