SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_03166T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_03166T0
Domain Number 1 Region: 1-154
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-28
Family Glutathione peroxidase-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SJAG_03166T0
Sequence length 155
Comment | SJAG_03166 | Schizosaccharomyces japonicus yFS275 thioredoxin peroxidase (156 aa)
Sequence
MIALGATLPSVELWENKPNNKVEFPDGKIIIVGVPGAFTPPCSSQVPGYVVAAEDFAAKG
VVGIYIVAVNDVFVTNAWKKNLGFENYENVHFVSDWNGEFTKALGAEFDASGLLGPVRSK
RYALVAENKKVQKIYVEGVVTDVDVSSAQNVLEEL
Download sequence
Identical sequences B6K3I1
SJAG_03166T0 XP_002174331.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]