SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_04222T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_04222T0
Domain Number 1 Region: 4-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.06e-34
Family spliceosomal protein U5-15Kd 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_04222T0
Sequence length 142
Comment | SJAG_04222 | Schizosaccharomyces japonicus yFS275 U4/U6 X U5 tri-snRNP complex subunit Dim1 (143 aa)
Sequence
MSYLLPHLHSGWHVDQAILSEQERLVVIRFGRDHDEECMKQDEVLYKVAEKVSNFAVIYL
VDIDEVPDFNKMYELYDRTTIMFFYRNKHMMVDLGTGNNNKINWALEDKQELIDIIETVY
RGARKGKGLVISPKDYSTRHRY
Download sequence
Identical sequences B6K694
SJAG_04222T0 XP_002175341.1.46972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]