SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SJAG_00217T0 from Schizosaccharomyces japonicus yFS275

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SJAG_00217T0
Domain Number 1 Region: 5-152
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.58e-25
Family NQO2-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SJAG_00217T0
Sequence length 163
Comment | SJAG_00217 | Schizosaccharomyces japonicus yFS275 predicted protein (164 aa)
Sequence
MKFFDRRSLEIARQLLRRYPKEWAQGATLPLLDLAQRQQGNFVPQAALREIADMTKSTIA
RVRATASQYEYIRLSDSGSPFRVCTSWMCEEKGAQALRKHAQREAKRLDVHINIESASCL
GGCHHAPVLWFQDRLYENMSCSDVAVVLKEEKVEEEAEEKESD
Download sequence
Identical sequences SJAG_00217T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]